PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0799s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 523aa    MW: 59601.9 Da    PI: 6.6662
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0799s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81.1e-093664031954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  L+k++gL+++qV +WF N R +
  Cagra.0799s0015.1.p 366 FEHflHPYPKESEKIMLSKQTGLSKNQVANWFINARVR 403
                          665559******************************88 PP

2BELL125.42.2e-40229300172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+v+glg+akpYts+Al++iSrhFrcL+dai+eqi
  Cagra.0799s0015.1.p 229 ERQELQNKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 300
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-51162298IPR006563POX domain
PfamPF075266.2E-48168296IPR006563POX domain
PROSITE profilePS5007112.066344407IPR001356Homeobox domain
CDDcd000865.00E-11347408No hitNo description
SMARTSM003891.9E-9347411IPR001356Homeobox domain
SuperFamilySSF466893.12E-17348414IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28350413IPR009057Homeodomain-like
PfamPF059201.8E-17364403IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MAVYYPNSVG MQSLYQESIY LNEQQQQQQA SSSSAASFSE IVSGDVRNNN EMVFIPPTSD  60
VAVNGNVTVS SNDLSFHGGG LSLSLGNQIQ SAVSVSPFQY HYQNLSNQLN YSNPNASTMS  120
DENGKSLSGH HHQQHHSDQM IPSSGYNNNG VGFFNNYRYE TSGFVSSVLR SRYLKPTQQL  180
LDEVVSVRKE LKLGNKKMKN DKGQDFQNGS SDNITEDEKS QSQELSPSER QELQNKKSKL  240
LTMVDEVDKR YNQYHHQMEA LASSFEMVTG LGAAKPYTSV ALNRISRHFR CLRDAIKEQI  300
QVIRGKLGER ETSEEQGERI PRLRYLDQRL RQQRALHQQL GMVRPAWRPQ RGLPENSVSI  360
LRAWLFEHFL HPYPKESEKI MLSKQTGLSK NQVANWFINA RVRLWKPMIE EMYKEEFGDS  420
ELLSNSNQEN NKMLETSQLK HEESSSQQQN QGNNNNNMAY RSDAEENLVF ADPKPDRVAT  480
GEYDSLMNYH GFGIDDYNRY VGLGNQQDGR FSNPHQLHDF VV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-16353411563Homeobox protein Meis2
3k2a_B9e-16353411563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302135.10.0hypothetical protein CARUB_v10020140mg
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLR0IEB00.0R0IEB0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3